PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00652g00422.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 322aa    MW: 36284.9 Da    PI: 6.4493
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00652g00422.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.92.6e-343387155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprlrWt eLHerFv+av+qLGG++kAtPkti++ m+vkgLtl+h+kSHLQkYRl
  Peaxi162Scf00652g00422.1 33 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMKSMGVKGLTLYHLKSHLQKYRL 87
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1073090IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-323088IPR009057Homeodomain-like
SuperFamilySSF466891.97E-173290IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-243388IPR006447Myb domain, plants
PfamPF002491.5E-93586IPR001005SANT/Myb domain
PfamPF143792.4E-25131177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MYSNGISDYH HHHHNFNNIM EDGTCLVLTA DHKPRLRWTA ELHERFVDAV TQLGGPDKAT  60
PKTIMKSMGV KGLTLYHLKS HLQKYRLGKQ SYKEATENNN DESSVTESQE VHSSTLSSSR  120
VVAQDINDGY QVTEAFREQM EVQRRLHEQL EVQRHVQLRV EAQGKYLQTI LEKACKALNY  180
KAAACPDLEA AREELSELAI KVSTDCDGIV TVSSFPEVIM SFENKNASNI SARIGDCLSD  240
DCLPSNRSPV SPMRIGALKK RPRAFANGDA LPVENNMRQT LRSSRRVRKD IAIEPEELER  300
ADPYEAPVVI HDLDEAEISK AM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794234.11e-158PREDICTED: myb family transcription factor APL-like isoform X2
RefseqXP_016467389.11e-158PREDICTED: myb family transcription factor APL-like isoform X2
TrEMBLM0ZZT51e-141M0ZZT5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000115981e-141(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-92G2-like family protein